PHF7 (NM_016483) Human Mass Spec Standard

CAT#: PH305192

PHF7 MS Standard C13 and N15-labeled recombinant protein (NP_057567)

Product Images

Coomassie blue staining of purified PHF7 protein (Cat# TP305192). The protein was produced from HEK293T cells transfected with PHF7 cDNA clone (Cat# RC205192) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205192
• Predicted MW: 43.8 kDa
• Protein Sequence:
  Sequence Link

  >RC205192 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKTVKEKKECQRLRKSAKTRRVTQRKPSSGPVCWLCLREPGDPEKLGEFLQKDNISVHYFCLILSSKLPQ
  RGQSNRGFHGFLPEDIKKEAARASRKICFVCKKKGAAINCQKDQCLRNFHLPCGQERGCLSQFFGEYKSF
  CDKHRPTQNIQHGHVGEESCILCCEDLSQQSVENIQSPCCSQAIYHRKCIQKYAHTSAKHFFKCPQCNNR
  KEFPQEMLRMGIHIPDRDAAWELEPGAFSDLYQRYQHCDAPICLYEQGRDSFEDEGRWCLILCATCGSHG
  THRDCSSLRSNSKKWECEECSPAAATDYIPENSGDIPCCSSTFHPEEHFCRDNTLEENPGLSWTDWPEPS
  LLEKPESSRGRRSYSWRSKGVRITNSCKKSK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057567
• RefSeq Size: 2240
• RefSeq ORF: 1143
• Synonyms: HSPC045; HSPC226; NYD-SP6
• Locus ID: 51533
• UniProt ID: Q9BWX1, A0A024R336
• Cytogenetics: 3p21.1
• Summary: Spermatogenesis is a complex process regulated by extracellular and intracellular factors as well as cellular interactions among interstitial cells of the testis, Sertoli cells, and germ cells. This gene is expressed in the testis in Sertoli cells but not germ cells. The protein encoded by this gene contains plant homeodomain (PHD) finger domains, also known as leukemia associated protein (LAP) domains, believed to be involved in transcriptional regulation. The protein, which localizes to the nucleus of transfected cells, has been implicated in the transcriptional regulation of spermatogenesis. Alternate splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013]
• Protein Families: Druggable Genome, Transcription Factors