DNAJC5B (NM_033105) Human Mass Spec Standard

CAT#: PH305251

DNAJC5B MS Standard C13 and N15-labeled recombinant protein (NP_149096)

Product Images

Coomassie blue staining of purified DNAJC5B protein (Cat# TP305251). The protein was produced from HEK293T cells transfected with DNAJC5B cDNA clone (Cat# RC205251) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205251
• Predicted MW: 22.5 kDa
• Protein Sequence:
  Sequence Link

  >RC205251 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDPAATEKFKEINNAHAI
  LTDISKRSIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKALFVIVGLLTGCYFCCCLCCCCNCCCGHC
  RPESSVPEEDFYVSPEDLEEQIKSDMEKDVDFPVFLQPTNANEKTQLIKEGSRSYCTDS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_149096
• RefSeq Size: 1398
• RefSeq ORF: 597
• Synonyms: CSP-beta
• Locus ID: 85479
• UniProt ID: Q9UF47, A0A024R7Z1
• Cytogenetics: 8q13.1
• Summary: This gene encodes a member of the DNAJ heat shock protein 40 family of co-chaperone proteins that is characterized by an N-terminal DNAJ domain, a linker region, and a cysteine-rich C-terminal domain. The encoded protein, together with heat shock protein 70, is thought to regulate the proper folding of other proteins. The orthologous mouse protein is membrane-associated and is targeted to the trans-golgi network. [provided by RefSeq, Mar 2017]