DNAJC5B (NM_033105) Human Recombinant Protein
CAT#: TP305251
Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 5 beta (DNAJC5B)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205251 protein sequence
Red=Cloning site Green=Tags(s) MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDPAATEKFKEINNAHAI LTDISKRSIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKALFVIVGLLTGCYFCCCLCCCCNCCCGHC RPESSVPEEDFYVSPEDLEEQIKSDMEKDVDFPVFLQPTNANEKTQLIKEGSRSYCTDS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_149096 |
Locus ID | 85479 |
UniProt ID | Q9UF47, A0A024R7Z1 |
Cytogenetics | 8q13.1 |
Refseq Size | 1398 |
Refseq ORF | 597 |
Synonyms | CSP-beta |
Summary | This gene encodes a member of the DNAJ heat shock protein 40 family of co-chaperone proteins that is characterized by an N-terminal DNAJ domain, a linker region, and a cysteine-rich C-terminal domain. The encoded protein, together with heat shock protein 70, is thought to regulate the proper folding of other proteins. The orthologous mouse protein is membrane-associated and is targeted to the trans-golgi network. [provided by RefSeq, Mar 2017] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409749 | DNAJC5B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY409749 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 5 beta (DNAJC5B) |
USD 325.00 |
|
PH305251 | DNAJC5B MS Standard C13 and N15-labeled recombinant protein (NP_149096) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review