CRHBP (NM_001882) Human Mass Spec Standard
CAT#: PH305258
CRHBP MS Standard C13 and N15-labeled recombinant protein (NP_001873)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205258 |
Predicted MW | 36 kDa |
Protein Sequence |
>RC205258 representing NM_001882
Red=Cloning site Green=Tags(s) MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQF TFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDF CESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSII YPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNT VVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001873 |
RefSeq Size | 1854 |
RefSeq ORF | 966 |
Synonyms | CRF-BP; CRFBP |
Locus ID | 1393 |
UniProt ID | P24387 |
Cytogenetics | 5q13.3 |
Summary | 'Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH-binding protein which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy. [provided by RefSeq, Jul 2008]' |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419679 | CRHBP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY419679 | Transient overexpression lysate of corticotropin releasing hormone binding protein (CRHBP) |
USD 396.00 |
|
TP305258 | Recombinant protein of human corticotropin releasing hormone binding protein (CRHBP) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review