NEUROD2 (NM_006160) Human Mass Spec Standard

CAT#: PH305293

NEUROD2 MS Standard C13 and N15-labeled recombinant protein (NP_006151)

Product Images

Coomassie blue staining of purified NEUROD2 protein (Cat# TP305293). The protein was produced from HEK293T cells transfected with NEUROD2 cDNA clone (Cat# RC205293) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205293
• Predicted MW: 41.3 kDa
• Protein Sequence:
  Sequence Link

  >RC205293 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLTRLFSEPGLLSDVPKFASWGDGEDDEPRSDKGDAPPPPPPAPGPGAPGPARAAKPVPLRGEEGTEATL
  AEVKEEGELGGEEEEEEEEEEGLDEAEGERPKKGGPKKRKMTKARLERSKLRRQKANARERNRMHDLNAA
  LDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKRPDLVSYVQTLCKGLSQPTTNLVAGCLQL
  NSRNFLTEQGADGAGRFHGSGGPFAMHPYPYPCSRLAGAQCQAAGGLGGGAAHALRTHGYCAAYETLYAA
  AGGGGASPDYNSSEYEGPLSPPLCLNGNFSLKQDSSPDHEKSYHYSMHYSALPGSRPTGHGLVFGSSAVR
  GGVHSENLLSYDMHLHHDRGPMYEELNAFFHN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006151
• RefSeq Size: 3048
• RefSeq ORF: 1146
• Synonyms: bHLHa1; EIEE72; NDRF
• Locus ID: 4761
• UniProt ID: Q15784
• Cytogenetics: 17q12
• Summary: 'This gene encodes a member of the neuroD family of neurogenic basic helix-loop-helix (bHLH) proteins. Expression of this gene can induce transcription from neuron-specific promoters, such as the GAP-43 promoter, which contain a specific DNA sequence known as an E-box. The product of the human gene can induce neurogenic differentiation in non-neuronal cells in Xenopus embryos, and is thought to play a role in the determination and maintenance of neuronal cell fates. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors