ALDH1A2 (NM_170696) Human Mass Spec Standard
CAT#: PH305342
ALDH1A2 MS Standard C13 and N15-labeled recombinant protein (NP_733797)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205342 |
Predicted MW | 53.1 kDa |
Protein Sequence |
>RC205342 protein sequence
Red=Cloning site Green=Tags(s) MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQ EADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDL QGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIK PAEQTPLSALYMGALIKEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQ CCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECG GKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKAL TVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_733797 |
RefSeq Size | 3492 |
RefSeq ORF | 1440 |
Synonyms | RALDH(II); RALDH2; RALDH2-T |
Locus ID | 8854 |
UniProt ID | O94788 |
Cytogenetics | 15q21.3 |
Summary | This protein belongs to the aldehyde dehydrogenase family of proteins. The product of this gene is an enzyme that catalyzes the synthesis of retinoic acid (RA) from retinaldehyde. Retinoic acid, the active derivative of vitamin A (retinol), is a hormonal signaling molecule that functions in developing and adult tissues. The studies of a similar mouse gene suggest that this enzyme and the cytochrome CYP26A1, concurrently establish local embryonic retinoic acid levels which facilitate posterior organ development and prevent spina bifida. Four transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, May 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Retinol metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403525 | ALDH1A2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC406883 | ALDH1A2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC418372 | ALDH1A2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC429167 | ALDH1A2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430305 | ALDH1A2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY403525 | Transient overexpression lysate of aldehyde dehydrogenase 1 family, member A2 (ALDH1A2), transcript variant 2 |
USD 325.00 |
|
LY406883 | Transient overexpression lysate of aldehyde dehydrogenase 1 family, member A2 (ALDH1A2), transcript variant 3 |
USD 495.00 |
|
LY418372 | Transient overexpression lysate of aldehyde dehydrogenase 1 family, member A2 (ALDH1A2), transcript variant 1 |
USD 495.00 |
|
LY429167 | Transient overexpression lysate of aldehyde dehydrogenase 1 family, member A2 (ALDH1A2), transcript variant 1 |
USD 325.00 |
|
LY430305 | Transient overexpression lysate of aldehyde dehydrogenase 1 family, member A2 (ALDH1A2), transcript variant 3 |
USD 325.00 |
|
PH323250 | ALDH1A2 MS Standard C13 and N15-labeled recombinant protein (NP_003879) |
USD 2,055.00 |
|
TP305342 | Recombinant protein of human aldehyde dehydrogenase 1 family, member A2 (ALDH1A2), transcript variant 2 |
USD 867.00 |
|
TP323250 | Recombinant protein of human aldehyde dehydrogenase 1 family, member A2 (ALDH1A2), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review