Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-ALDH1A2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of humanALDH1A2. |
Rabbit Polyclonal Anti-ALDH1A2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Aldh1a2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Aldh1a2. Synthetic peptide located within the following region: ALMVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEV |
Rabbit Polyclonal Anti-ALDH1A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH1A2 antibody: synthetic peptide directed towards the N terminal of human ALDH1A2. Synthetic peptide located within the following region: PVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRL |
Anti-ALDH1A2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 5-19 amino acids of human aldehyde dehydrogenase 1 family, member A2 |
ALDH1A2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ALDH1A2 |
ALDH1A2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human ALDH1A2 (NP_733797.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ALDH1A2