ALDH1A2 Rabbit Polyclonal Antibody

CAT#: TA342735

Rabbit Polyclonal Anti-ALDH1A2 Antibody

Product Images

Host: Rabbit; Target Name: Aldh1a2; Sample Tissue: Mouse Testis lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Aldh1a2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Aldh1a2. Synthetic peptide located within the following region: ALMVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: aldehyde dehydrogenase 1 family member A2
• Database Link:
  NP_003879
  Entrez Gene 19378 Mouse
  UniProt ID O94788
• Background: Aldh1a2 recognizes as substrates free retinal and cellular retinol-binding protein-bound retinal. It does metabolize octanal and decanal but does not metabolize citral, benzaldehyde, acetaldehyde and propanal efficiently.
• Synonyms: RALDH(II); RALDH2; RALDH2-T
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%; Sheep: 83%; Yeast

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Retinol metabolism