RIT2 (NM_002930) Human Mass Spec Standard

CAT#: PH305367

RIT2 MS Standard C13 and N15-labeled recombinant protein (NP_002921)

Product Images

Coomassie blue staining of purified RIT2 protein (Cat# TP305367). The protein was produced from HEK293T cells transfected with RIT2 cDNA clone (Cat# RC205367) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205367
• Predicted MW: 24.7 kDa
• Protein Sequence:
  Sequence Link

  >RC205367 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYL
  DILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQF
  RQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVREIRKKESMPSLMEKKLKRKDCLWKKLKGSLK
  KKRENMT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002921
• RefSeq Size: 1102
• RefSeq ORF: 651
• Synonyms: RIBA; RIN; ROC2
• Locus ID: 6014
• UniProt ID: Q99578
• Cytogenetics: 18q12.3
• Summary: 'RIN belongs to the RAS (HRAS; MIM 190020) superfamily of small GTPases (Shao et al., 1999 [PubMed 10545207]).[supplied by OMIM, Mar 2008]'