CT45A5 (NM_001007551) Human Mass Spec Standard

CAT#: PH305570

CT45A5 MS Standard C13 and N15-labeled recombinant protein (NP_001007552)

Product Images

Coomassie blue staining of purified CT45A5 protein (Cat# TP305570). The protein was produced from HEK293T cells transfected with CT45A5 cDNA clone (Cat# RC205570) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205570
• Predicted MW: 21.3 kDa
• Protein Sequence:
  Sequence Link

  >RC205570 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLD
  SQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQK
  YEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001007552
• RefSeq Size: 1321
• RefSeq ORF: 567
• Synonyms: CT45-3; CT45-4; CT45-6; CT45.5; CT45A3; CT45A4; CT45A6; CT45A7; CT455
• Locus ID: 441521
• UniProt ID: P0DMU8, P0DMU7, P0DMV0
• Cytogenetics: Xq26.3
• Summary: This gene represents one of a cluster of several similar genes located on the q arm of chromosome X. The genes in this cluster encode members of the cancer/testis (CT) family of antigens, and are distinct from other CT antigens. These antigens are thought to be novel therapeutic targets for human cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014]