CT45A5 (NM_001007551) Human Recombinant Protein
CAT#: TP305570
Recombinant protein of human cancer/testis antigen family 45, member A5 (CT45A5)
View other "CT45A5" proteins (6)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205570 protein sequence
Red=Cloning site Green=Tags(s) MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLD SQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQK YEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001007552 |
Locus ID | 441521 |
UniProt ID | Q6NSH3, P0DMU8, P0DMU7, P0DMV0 |
Cytogenetics | Xq26.3 |
Refseq Size | 1321 |
Refseq ORF | 567 |
Synonyms | CT45-3; CT45-4; CT45-6; CT45.5; CT45A3; CT45A4; CT45A6; CT45A7; CT455 |
Summary | This gene represents one of a cluster of several similar genes located on the q arm of chromosome X. The genes in this cluster encode members of the cancer/testis (CT) family of antigens, and are distinct from other CT antigens. These antigens are thought to be novel therapeutic targets for human cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423509 | CT45A5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC432655 | CT45A5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY423509 | Transient overexpression lysate of cancer/testis antigen family 45, member A5 (CT45A5), transcript variant 1 |
USD 396.00 |
|
LY432655 | Transient overexpression lysate of cancer/testis antigen family 45, member A5 (CT45A5), transcript variant 2 |
USD 396.00 |
|
PH305570 | CT45A5 MS Standard C13 and N15-labeled recombinant protein (NP_001007552) |
USD 2,055.00 |
|
TP329655 | Purified recombinant protein of Homo sapiens cancer/testis antigen family 45, member A5 (CT45A5), transcript variant 2. |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review