ADO (NM_032804) Human Mass Spec Standard

CAT#: PH305583

ADO MS Standard C13 and N15-labeled recombinant protein (NP_116193)

Product Images

Coomassie blue staining of purified ADO protein (Cat# TP305583). The protein was produced from HEK293T cells transfected with ADO cDNA clone (Cat# RC205583) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205583
• Predicted MW: 29.9 kDa
• Protein Sequence:
  Sequence Link

  >RC205583 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPRDNMASLIQRIARQACLTFRGSWGGRGASDRDAASGAEAPMQPGFPENLSKLKSLLTQLRAEDLNIAP
  RKATLQPLPPNLPPVTYMHIYETDGFSLGVFLLKSGTSIPLHDHPGMHGMLKVLYGTVRISCMDKLDAGG
  GQRPRALPPEQQFEPPLQPREREAVRPGVLRSRAEYTEASGPCILTPHRDNLHQIDAVEGPAAFLDILAP
  PYDPDDGRDCHYYRVLEPVRPKEASSSACDLPREVWLLETPQADDFWCEGEPYPGPKVFP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_116193
• RefSeq Size: 3739
• RefSeq ORF: 810
• Synonyms: C10orf22
• Locus ID: 84890
• UniProt ID: Q96SZ5, B3KXN9
• Cytogenetics: 10q21.3
• Summary: Human thiol dioxygenases include cysteine dioxygenase (CDO; MIM 603943) and cysteamine (2-aminoethanethiol) dioxygenase (ADO; EC 1.13.11.19). CDO adds 2 oxygen atoms to free cysteine, whereas ADO adds 2 oxygen atoms to free cysteamine to form hypotaurine (Dominy et al., 2007 [PubMed 17581819]). [supplied by OMIM, Mar 2008]
• Protein Pathways: Metabolic pathways, Taurine and hypotaurine metabolism