COMMD1 (NM_152516) Human Mass Spec Standard
CAT#: PH305614
COMMD1 MS Standard C13 and N15-labeled recombinant protein (NP_689729)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205614 |
Predicted MW | 21.2 kDa |
Protein Sequence |
>RC205614 protein sequence
Red=Cloning site Green=Tags(s) MAAGELEGGKPLSGLLNALAQDTFHGYPGITEELLRSQLYPEVPPEEFRPFLAKMRGILKSIASADMDFN QLEAFLTAQTKKQGGITSDQAAVISKFWKSHKTKIRESLMNQSRWNSGLRGLSWRVDGKSQSRHSAQIHT PVAIIELELGKYGQESEFLCLEFDEVKVNQILKTLSEVEESISTLISQPN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_689729 |
RefSeq Size | 725 |
RefSeq ORF | 570 |
Synonyms | C2orf5; MURR1 |
Locus ID | 150684 |
UniProt ID | Q8N668 |
Cytogenetics | 2p15 |
Summary | COMMD1 is a regulator of copper homeostasis, sodium uptake, and NF-kappa-B (see MIM 164011) signaling (de Bie et al., 2005 [PubMed 16267171]). [supplied by OMIM, Sep 2009] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403473 | COMMD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403473 | Transient overexpression lysate of copper metabolism (Murr1) domain containing 1 (COMMD1) |
USD 396.00 |
|
TP305614 | Recombinant protein of human copper metabolism (Murr1) domain containing 1 (COMMD1) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review