COMMD1 (NM_152516) Human Mass Spec Standard

CAT#: PH305614

COMMD1 MS Standard C13 and N15-labeled recombinant protein (NP_689729)

Product Images

Coomassie blue staining of purified COMMD1 protein (Cat# TP305614). The protein was produced from HEK293T cells transfected with COMMD1 cDNA clone (Cat# RC205614) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205614
• Predicted MW: 21.2 kDa
• Protein Sequence:
  Sequence Link

  >RC205614 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAGELEGGKPLSGLLNALAQDTFHGYPGITEELLRSQLYPEVPPEEFRPFLAKMRGILKSIASADMDFN
  QLEAFLTAQTKKQGGITSDQAAVISKFWKSHKTKIRESLMNQSRWNSGLRGLSWRVDGKSQSRHSAQIHT
  PVAIIELELGKYGQESEFLCLEFDEVKVNQILKTLSEVEESISTLISQPN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_689729
• RefSeq Size: 725
• RefSeq ORF: 570
• Synonyms: C2orf5; MURR1
• Locus ID: 150684
• UniProt ID: Q8N668
• Cytogenetics: 2p15
• Summary: COMMD1 is a regulator of copper homeostasis, sodium uptake, and NF-kappa-B (see MIM 164011) signaling (de Bie et al., 2005 [PubMed 16267171]). [supplied by OMIM, Sep 2009]