CDC25C (NM_001790) Human Mass Spec Standard

CAT#: PH305641

CDC25C MS Standard C13 and N15-labeled recombinant protein (NP_001781)

Product Images

Coomassie blue staining of purified CDC25C protein (Cat# TP305641). The protein was produced from HEK293T cells transfected with CDC25C cDNA clone (Cat# RC205641) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205641
• Predicted MW: 53.3 kDa
• Protein Sequence:
  Sequence Link

  >RC205641 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKC
  CLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRK
  RDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSG
  LYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQG
  HLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQ
  EELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFF
  PEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001781
• RefSeq Size: 2191
• RefSeq ORF: 1419
• Synonyms: CDC25; PPP1R60
• Locus ID: 995
• UniProt ID: P30307
• Cytogenetics: 5q31.2
• Summary: 'This gene encodes a conserved protein that plays a key role in the regulation of cell division. The encoded protein directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It also suppresses p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described. [provided by RefSeq, Dec 2015]'
• Protein Families: Druggable Genome, Phosphatase, Stem cell - Pluripotency
• Protein Pathways: Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation