CDC25C (NM_001790) Human Recombinant Protein

CAT#: TP305641

Recombinant protein of human cell division cycle 25 homolog C (S. pombe) (CDC25C), transcript variant 1

Product Images

Coomassie blue staining of purified CDC25C protein (Cat# TP305641). The protein was produced from HEK293T cells transfected with CDC25C cDNA clone (Cat# RC205641) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205641 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKC
  CLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRK
  RDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSG
  LYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQG
  HLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQ
  EELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFF
  PEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 53.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001781
• Locus ID: 995
• UniProt ID: P30307
• Cytogenetics: 5q31.2
• Refseq Size: 2191
• Refseq ORF: 1419
• Synonyms: CDC25; PPP1R60
• Summary: This gene encodes a conserved protein that plays a key role in the regulation of cell division. The encoded protein directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It also suppresses p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described. [provided by RefSeq, Dec 2015]
• Protein Families: Druggable Genome, Phosphatase, Stem cell - Pluripotency
• Protein Pathways: Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation