Neurokinin B (TAC3) (NM_013251) Human Mass Spec Standard
CAT#: PH305666
TAC3 MS Standard C13 and N15-labeled recombinant protein (NP_037383)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205666 |
| Predicted MW | 13.4 kDa |
| Protein Sequence |
>RC205666 protein sequence
Red=Cloning site Green=Tags(s) MRIMLLFTAILAFSLAQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTD PKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_037383 |
| RefSeq Size | 841 |
| RefSeq ORF | 363 |
| Synonyms | HH10; NKB; NKNB; PRO1155; ZNEUROK1 |
| Locus ID | 6866 |
| UniProt ID | Q9UHF0, A0A024RB47 |
| Cytogenetics | 12q13.3 |
| Summary | 'This gene encodes a member of the tachykinin family of secreted neuropeptides. The encoded preproprotein is proteolytically processed to generate the mature peptide, which is primarily expressed in the central and peripheral nervous systems and functions as a neurotransmitter. This peptide is the ligand for the neurokinin-3 receptor. This protein is also expressed in the outer syncytiotrophoblast of the placenta and may be associated with pregnancy-induced hypertension and pre-eclampsia. Mutations in this gene are associated with normosmic hypogonadotropic hypogonadism. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Feb 2016]' |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415710 | TAC3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY415710 | Transient overexpression lysate of tachykinin 3 (TAC3) |
USD 436.00 |
|
| TP305666 | Recombinant protein of human tachykinin 3 (TAC3) |
USD 823.00 |
|
| TP720967 | Purified recombinant protein of Human tachykinin 3 (TAC3), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China