SPR (NM_003124) Human Mass Spec Standard

CAT#: PH305679

SPR MS Standard C13 and N15-labeled recombinant protein (NP_003115)

Product Images

Coomassie blue staining of purified SPR protein (Cat# TP305679). The protein was produced from HEK293T cells transfected with SPR cDNA clone (Cat# RC205679) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205679
• Predicted MW: 28 kDa
• Protein Sequence:
  Sequence Link

  >RC205679 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADL
  GAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLK
  AFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLAR
  ETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003115
• RefSeq Size: 1466
• RefSeq ORF: 783
• Synonyms: SDR38C1
• Locus ID: 6697
• UniProt ID: P35270
• Cytogenetics: 2p13.2
• Summary: This gene encodes an aldo-keto reductase that catalyzes the NADPH-dependent reduction of pteridine derivatives and is important in the biosynthesis of tetrahydrobiopterin (BH4). Mutations in this gene result in DOPA-responsive dystonia due to sepiaterin reductase deficiency. A pseudogene has been identified on chromosome 1. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Folate biosynthesis, Metabolic pathways