RRM2 (NM_001034) Human Mass Spec Standard

CAT#: PH305718

RRM2 MS Standard C13 and N15-labeled recombinant protein (NP_001025)

Product Images

Coomassie blue staining of purified RRM2 protein (Cat# TP305718). The protein was produced from HEK293T cells transfected with RRM2 cDNA clone (Cat# RC205718) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205718
• Predicted MW: 44.7 kDa
• Protein Sequence:
  Sequence Link

  >RC205718 representing NM_001034
  Red=Cloning site Green=Tags(s)
  
  MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDE
  PLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAASDGI
  VNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWA
  LRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHL
  VHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFM
  ENISLEGKTNFFEKRVGEYQRMGVMSSPTENSFTLDADF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001025
• RefSeq Size: 2500
• RefSeq ORF: 1167
• Synonyms: C2orf48; R2; RR2; RR2M
• Locus ID: 6241
• UniProt ID: P31350
• Cytogenetics: 2p25.1
• Summary: 'This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms that differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X. [provided by RefSeq, Sep 2009]'
• Protein Families: Druggable Genome
• Protein Pathways: Glutathione metabolism, Metabolic pathways, p53 signaling pathway, Purine metabolism, Pyrimidine metabolism