CUTC (NM_015960) Human Mass Spec Standard

CAT#: PH305748

CUTC MS Standard C13 and N15-labeled recombinant protein (NP_057044)

Product Images

Coomassie blue staining of purified CUTC protein (Cat# TP305748). The protein was produced from HEK293T cells transfected with CUTC cDNA clone (Cat# RC205748) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205748
• Predicted MW: 29.3 kDa
• Protein Sequence:
  Sequence Link

  >RC205748 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKRQGASSERKRARIPSGKAGAANGFLMEVCVDSVESAVNAERGGADRIELCSGLSEGGTTPSMGVLQVV
  KQSVQIPVFVMIRPRGGDFLYSDREIEVMKADIRLAKLYGADGLVFGALTEDGHIDKELCMSLMAICRPL
  PVTFHRAFDMVHDPMAALETLLTLGFERVLTSGCDSSALEGLPLIKRLIEQAKGRIVVMPGGGITDRNLQ
  RILEGSGATEFHCSARSTRDSGMKFRNSSVAMGASLSCSEYSLKVTDVTKVRTLNAIAKNILV
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057044
• RefSeq Size: 1378
• RefSeq ORF: 819
• Synonyms: CGI-32
• Locus ID: 51076
• UniProt ID: Q9NTM9
• Cytogenetics: 10q24.2
• Summary: Members of the CUT family of copper transporters are associated with copper homeostasis and are involved in the uptake, storage, delivery, and efflux of copper (Gupta et al., 1995 [PubMed 7635807]; Li et al., 2005 [PubMed 16182249]). [supplied by OMIM, Mar 2008]