MTHFS (NM_006441) Human Mass Spec Standard

CAT#: PH305749

MTHFS MS Standard C13 and N15-labeled recombinant protein (NP_006432)

Product Images

Coomassie blue staining of purified MTHFS protein (Cat# TP305749). The protein was produced from HEK293T cells transfected with MTHFS cDNA clone (Cat# RC205749) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205749
• Predicted MW: 23.3 kDa
• Protein Sequence:
  Sequence Link

  >RC205749 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKD
  IFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFD
  KHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006432
• RefSeq Size: 2346
• RefSeq ORF: 609
• Synonyms: HsT19268; NEDMEHM
• Locus ID: 10588
• UniProt ID: P49914
• Cytogenetics: 15q25.1
• Summary: The protein encoded by this gene is an enzyme that catalyzes the conversion of 5-formyltetrahydrofolate to 5,10-methenyltetrahydrofolate, a precursor of reduced folates involved in 1-carbon metabolism. An increased activity of the encoded protein can result in an increased folate turnover rate and folate depletion. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jun 2011]
• Protein Pathways: Metabolic pathways, One carbon pool by folate