C15orf40 (NM_144597) Human Mass Spec Standard

CAT#: PH305773

C15orf40 MS Standard C13 and N15-labeled recombinant protein (NP_653198)

Product Images

Coomassie blue staining of purified C15orf40 protein (Cat# TP305773). The protein was produced from HEK293T cells transfected with C15orf40 cDNA clone (Cat# RC205773) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205773
• Predicted MW: 13.3 kDa
• Protein Sequence:
  Sequence Link

  >RC205773 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPKKAGATTKGKSQSKEPERPLPPLGPVAVDPKGCVTIAIHAKPGSKQNAVTDLTAEAVNVAIAAPPSEG
  EANAELCRYLSKVLELRKSDVVLDKGGKSREKVVKLLASTTPEEILEKLKKEAKKT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_653198
• RefSeq Size: 1700
• RefSeq ORF: 378
• Synonyms: FLJ33606; MGC29937
• Locus ID: 123207
• UniProt ID: Q8WUR7
• Cytogenetics: 15q25.2
• Summary: Belongs to the UPF0235 family. [UniProtKB/Swiss-Prot Function]