CEBP Beta (CEBPB) (NM_005194) Human Mass Spec Standard

CAT#: PH305882

CEBPB MS Standard C13 and N15-labeled recombinant protein (NP_005185)

Product Images

Coomassie blue staining of purified CEBPB protein (Cat# TP305882). The protein was produced from HEK293T cells transfected with CEBPB cDNA clone (Cat# RC205882) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205882
• Predicted MW: 35.9 kDa
• Protein Sequence:
  Sequence Link

  >RC205882 representing NM_005194
  Red=Cloning site Green=Tags(s)
  
  MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHE
  RAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYV
  SLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAY
  LGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRER
  NNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005185
• RefSeq Size: 1837
• RefSeq ORF: 1035
• Synonyms: C/EBP-beta; IL6DBP; NF-IL6; TCF5
• Locus ID: 1051
• UniProt ID: P17676
• Cytogenetics: 20q13.13
• Summary: 'This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of this protein is important in the regulation of genes involved in immune and inflammatory responses, among other processes. The use of alternative in-frame AUG start codons results in multiple protein isoforms, each with distinct biological functions. [provided by RefSeq, Oct 2013]'
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors