CLIC5 (NM_016929) Human Mass Spec Standard
CAT#: PH305906
CLIC5 MS Standard C13 and N15-labeled recombinant protein (NP_058625)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205906 |
Predicted MW | 28.2 kDa |
Protein Sequence |
>RC205906 protein sequence
Red=Cloning site Green=Tags(s) MTDSATANGDDRDPEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGT HPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERG LTKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAE MTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_058625 |
RefSeq Size | 5752 |
RefSeq ORF | 753 |
Synonyms | DFNB102; DFNB103; MST130; MSTP130 |
Locus ID | 53405 |
UniProt ID | Q9NZA1, Q53G01 |
Cytogenetics | 6p21.1 |
Summary | This gene encodes a member of the chloride intracellular channel (CLIC) family of chloride ion channels. The encoded protein associates with actin-based cytoskeletal structures and may play a role in multiple processes including hair cell stereocilia formation, myoblast proliferation and glomerular podocyte and endothelial cell maintenance. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011] |
Protein Families | Druggable Genome, Ion Channels: Other |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402589 | CLIC5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426442 | CLIC5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402589 | Transient overexpression lysate of chloride intracellular channel 5 (CLIC5), transcript variant 2 |
USD 396.00 |
|
LY426442 | Transient overexpression lysate of chloride intracellular channel 5 (CLIC5), transcript variant 1 |
USD 396.00 |
|
TP305906 | Recombinant protein of human chloride intracellular channel 5 (CLIC5), transcript variant 2 |
USD 823.00 |
|
TP720188 | Recombinant protein of human chloride intracellular channel 5 (CLIC5), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review