CLIC5 (NM_016929) Human Mass Spec Standard

CAT#: PH305906

CLIC5 MS Standard C13 and N15-labeled recombinant protein (NP_058625)

Product Images

Coomassie blue staining of purified CLIC5 protein (Cat# TP305906). The protein was produced from HEK293T cells transfected with CLIC5 cDNA clone (Cat# RC205906) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205906
• Predicted MW: 28.2 kDa
• Protein Sequence:
  Sequence Link

  >RC205906 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTDSATANGDDRDPEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGT
  HPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERG
  LTKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAE
  MTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_058625
• RefSeq Size: 5752
• RefSeq ORF: 753
• Synonyms: DFNB102; DFNB103; MST130; MSTP130
• Locus ID: 53405
• UniProt ID: Q9NZA1, Q53G01
• Cytogenetics: 6p21.1
• Summary: This gene encodes a member of the chloride intracellular channel (CLIC) family of chloride ion channels. The encoded protein associates with actin-based cytoskeletal structures and may play a role in multiple processes including hair cell stereocilia formation, myoblast proliferation and glomerular podocyte and endothelial cell maintenance. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]
• Protein Families: Druggable Genome, Ion Channels: Other