CRIP2 (NM_001312) Human Mass Spec Standard

CAT#: PH305938

CRIP2 MS Standard C13 and N15-labeled recombinant protein (NP_001303)

Product Images

Coomassie blue staining of purified CRIP2 protein (Cat# TP305938). The protein was produced from HEK293T cells transfected with CRIP2 cDNA clone (Cat# RC205938) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205938
• Predicted MW: 22.5 kDa
• Protein Sequence:
  Sequence Link

  >RC205938 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIG
  GAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVT
  SLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001303
• RefSeq Size: 1247
• RefSeq ORF: 624
• Synonyms: CRIP; CRP2; ESP1
• Locus ID: 1397
• UniProt ID: P52943
• Cytogenetics: 14q32.33
• Summary: This gene encodes a putative transcription factor with two LIM zinc-binding domains. The encoded protein may participate in the differentiation of smooth muscle tissue. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]