CRIP2 (NM_001312) Human Recombinant Protein
CAT#: TP305938
Recombinant protein of human cysteine-rich protein 2 (CRIP2)
View other "CRIP2" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205938 protein sequence
Red=Cloning site Green=Tags(s) MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIG GAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVT SLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001303 |
Locus ID | 1397 |
UniProt ID | P52943 |
Cytogenetics | 14q32.33 |
Refseq Size | 1247 |
Refseq ORF | 624 |
Synonyms | CRIP; CRP2; ESP1 |
Summary | This gene encodes a putative transcription factor with two LIM zinc-binding domains. The encoded protein may participate in the differentiation of smooth muscle tissue. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420019 | CRIP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY420019 | Transient overexpression lysate of cysteine-rich protein 2 (CRIP2) |
USD 396.00 |
|
PH305938 | CRIP2 MS Standard C13 and N15-labeled recombinant protein (NP_001303) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review