MOBKL2B (MOB3B) (NM_024761) Human Mass Spec Standard

CAT#: PH305977

MOBKL2B MS Standard C13 and N15-labeled recombinant protein (NP_079037)

Product Images

Coomassie blue staining of purified MOB3B protein (Cat# TP305977). The protein was produced from HEK293T cells transfected with MOB3B cDNA clone (Cat# RC205977) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205977
• Predicted MW: 25.5 kDa
• Protein Sequence:
  Sequence Link

  >RC205977 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSIALKQVFNKDKTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWVAVHVVDFFNR
  INLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNEEIFPTCVG
  VPFPKNFLQICMKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYFVTEMNLIDRKELEPLKEM
  TSRMCH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_079037
• RefSeq Size: 6528
• RefSeq ORF: 648
• Synonyms: C9orf35; MOB1D; MOBKL2B
• Locus ID: 79817
• UniProt ID: Q86TA1
• Cytogenetics: 9p21.2
• Summary: The protein encoded by this gene shares similarity with the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. This gene is located on the opposite strand as the interferon kappa precursor (IFNK) gene. [provided by RefSeq, Jul 2008]