NME5 (NM_003551) Human Mass Spec Standard

CAT#: PH306058

NME5 MS Standard C13 and N15-labeled recombinant protein (NP_003542)

Product Images

Coomassie blue staining of purified NME5 protein (Cat# TP306058). The protein was produced from HEK293T cells transfected with NME5 cDNA clone (Cat# RC206058) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206058
• Predicted MW: 24.2 kDa
• Protein Sequence:
  Sequence Link

  >RC206058 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEISMPPPQIYVEKTLAIIKPDIVDKEEEIQDIILRSGFTIVQRRKLRLSPEQCSNFYVEKYGKMFFPNL
  TAYMSSGPLVAMILARHKAISYWLELLGPNNSLVAKETHPDSLRAIYGTDDLRNALHGSNDFAAAEREIR
  FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPIVEE
  PY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003542
• RefSeq Size: 1243
• RefSeq ORF: 636
• Synonyms: NM23-H5; NM23H5; RSPH23
• Locus ID: 8382
• UniProt ID: P56597, A0A0S2Z4L9
• Cytogenetics: 5q31.2
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Purine metabolism, Pyrimidine metabolism