COX6B2 (NM_144613) Human Mass Spec Standard

CAT#: PH306224

COX6B2 MS Standard C13 and N15-labeled recombinant protein (NP_653214)

Product Images

Coomassie blue staining of purified COX6B2 protein (Cat# TP306224). The protein was produced from HEK293T cells transfected with COX6B2 cDNA clone (Cat# RC206224) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206224
• Predicted MW: 10.5 kDa
• Protein Sequence:
  Sequence Link

  >RC206224 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPIS
  WVESWNEQIKNGIFAGKI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_653214
• RefSeq Size: 1679
• RefSeq ORF: 264
• Synonyms: COXVIB2; CT59
• Locus ID: 125965
• UniProt ID: Q6YFQ2
• Cytogenetics: 19q13.42
• Summary: Connects the two COX monomers into the physiological dimeric form. [UniProtKB/Swiss-Prot Function]
• Protein Pathways: Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease