COX6B2 (NM_144613) Human Recombinant Protein

CAT#: TP306224

Recombinant protein of human cytochrome c oxidase subunit VIb polypeptide 2 (testis) (COX6B2)

Product Images

Coomassie blue staining of purified COX6B2 protein (Cat# TP306224). The protein was produced from HEK293T cells transfected with COX6B2 cDNA clone (Cat# RC206224) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206224 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPIS
  WVESWNEQIKNGIFAGKI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_653214
• Locus ID: 125965
• UniProt ID: Q6YFQ2
• Cytogenetics: 19q13.42
• Refseq Size: 1679
• Refseq ORF: 264
• Synonyms: COXVIB2; CT59
• Summary: Connects the two COX monomers into the physiological dimeric form.[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease