RHOBTB1 (NM_014836) Human Mass Spec Standard
CAT#: PH306310
RHOBTB1 MS Standard C13 and N15-labeled recombinant protein (NP_055651)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206310 |
Predicted MW | 79.4 kDa |
Protein Sequence |
>RC206310 protein sequence
Red=Cloning site Green=Tags(s) MDADMDYERPNVETIKCVVVGDNAVGKTRLICARACNTTLTQYQLLATHVPTVWAIDQYRVCQEVLERSR DVVDEVSVSLRLWDTFGDHHKDRRFAYGRSDVVVLCFSIANPNSLNHVKSMWYPEIKHFCPRTPVILVGC QLDLRYADLEAVNRARRPLARPIKRGDILPPEKGREVAKELGLPYYETSVFDQFGIKDVFDNAIRAALIS RRHLQFWKSHLKKVQKPLLQAPFLPPKAPPPVIKIPECPSMGTNEAACLLDNPLCADVLFILQDQEHIFA HRIYLATSSSKFYDLFLMECEESPNGSEGACEKEKQSRDFQGRILSVDPEEEREEGPPRIPQADQWKSSN KSLVEALGLEAEGAVPETQTLTGWSKGFIGMHREMQVNPISKRMGPMTVVRMDASVQPGPFRTLLQFLYT GQLDEKEKDLVGLAQIAEVLEMFDLRMMVENIMNKEAFMNQEITKAFHVRKANRIKECLSKGTFSDVTFK LDDGAISAHKPLLICSCEWMAAMFGGSFVESANSEVYLPNINKISMQAVLDYLYTKQLSPNLDLDPLELI ALANRFCLPHLVALAEQHAVQELTKAATSGVGIDGEVLSYLELAQFHNAHQLAAWCLHHICTNYNSVCSK FRKEIKSKSADNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDIALNKHRSRRKWCFWNSSPAVA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_055651 |
RefSeq Size | 4515 |
RefSeq ORF | 2088 |
Synonyms | KIAA0740; MGC33059; MGC33841 |
Locus ID | 9886 |
UniProt ID | O94844, A0A024QZL4 |
Cytogenetics | 10q21.2 |
Summary | The protein encoded by this gene belongs to the Rho family of the small GTPase superfamily. It contains a GTPase domain, a proline-rich region, a tandem of 2 BTB (broad complex, tramtrack, and bric-a-brac) domains, and a conserved C-terminal region. The protein plays a role in small GTPase-mediated signal transduction and the organization of the actin filament system. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Dec 2008] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404953 | RHOBTB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC414991 | RHOBTB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422316 | RHOBTB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC425529 | RHOBTB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY404953 | Transient overexpression lysate of Rho-related BTB domain containing 1 (RHOBTB1), transcript variant 2 |
USD 605.00 |
|
LY414991 | Transient overexpression lysate of Rho-related BTB domain containing 1 (RHOBTB1), transcript variant 1 |
USD 396.00 |
|
LY422316 | Transient overexpression lysate of Rho-related BTB domain containing 1 (RHOBTB1), transcript variant 3 |
USD 605.00 |
|
LY425529 | Transient overexpression lysate of Rho-related BTB domain containing 1 (RHOBTB1), transcript variant 3 |
USD 605.00 |
|
TP306310 | Recombinant protein of human Rho-related BTB domain containing 1 (RHOBTB1), transcript variant 1 |
USD 867.00 |
|
TP761967 | Purified recombinant protein of Human Rho-related BTB domain containing 1 (RHOBTB1), transcript variant 3,full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review