MAGEB18 (NM_173699) Human Mass Spec Standard

CAT#: PH306329

MAGEB18 MS Standard C13 and N15-labeled recombinant protein (NP_775970)

Product Images

Coomassie blue staining of purified MAGEB18 protein (Cat# TP306329). The protein was produced from HEK293T cells transfected with MAGEB18 cDNA clone (Cat# RC206329) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206329
• Predicted MW: 38.5 kDa
• Protein Sequence:
  Sequence Link

  >RC206329 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPRGQKSKLRAREKRHQARCENQDLGATQATVAEGESPSSAYLLFGDRPQNLPAAETPSIPEALQGAPST
  TNAIAPVSCSSNEGASSQDEKSLGSSREAEGWKEDPLNKKVVSLVHFLLQKYETKEPITKGDMIKFVIRK
  DKCHFNEILKRASEHMELALGVDLKEVDPIRHYYAFFSKLDLTYDETTSDEEKIPKTGLLMIALGVIFLN
  GNRAPEEAVWEIMNMMGVYADRKHFLYGDPRKVMTKDLVQLKYLEYQQVPNSDPPRYEFLWGPRAHAETS
  KMKVLEFVAKIHDTVPSAFPSCYEEALRDEEQRTQARAAARAHTAAMANARSRTTSSSFSHAK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_775970
• RefSeq Size: 1812
• RefSeq ORF: 1029
• Synonyms: MGC33889
• Locus ID: 286514
• UniProt ID: Q96M61
• Cytogenetics: Xp21.3
• Summary: May enhance ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex. [UniProtKB/Swiss-Prot Function]