MOB4A (MOB1B) (NM_173468) Human Mass Spec Standard

CAT#: PH306337

MOBKL1A MS Standard C13 and N15-labeled recombinant protein (NP_775739)

Product Images

Coomassie blue staining of purified MOB1B protein (Cat# TP306337). The protein was produced from HEK293T cells transfected with MOB1B cDNA clone (Cat# RC206337) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206337
• Predicted MW: 25.1 kDa
• Protein Sequence:
  Sequence Link

  >RC206337 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINM
  LYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPF
  PKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEK
  LTSKDR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_775739
• RefSeq Size: 6979
• RefSeq ORF: 648
• Synonyms: MATS2; MOB4A; MOBKL1A
• Locus ID: 92597
• UniProt ID: Q7L9L4
• Cytogenetics: 4q13.3
• Summary: The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]