NR1D2 (NM_005126) Human Mass Spec Standard

CAT#: PH306338

NR1D2 MS Standard C13 and N15-labeled recombinant protein (NP_005117)

Product Images

Coomassie blue staining of purified NR1D2 protein (Cat# TP306338). The protein was produced from HEK293T cells transfected with NR1D2 cDNA clone (Cat# RC206338) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206338
• Predicted MW: 64.7 kDa
• Protein Sequence:
  Sequence Link

  >RC206338 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEVNAGGVIAYISSSSSASSHASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDLANIEGILKND
  RIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKC
  LKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLIEMQSAMKTMMNSQFSGHLQND
  TLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQ
  PKRGERIRKNMEQYNLNHDHCGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAY
  TQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFA
  KRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFEFS
  EKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFTKLLLKLPD
  LRSLNNMHSEELLAFKVHP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005117
• RefSeq Size: 5268
• RefSeq ORF: 1737
• Synonyms: BD73; EAR-1R; REVERBB; REVERBbeta; RVR
• Locus ID: 9975
• UniProt ID: Q14995, F1D8P2
• Cytogenetics: 3p24.2
• Summary: This gene encodes a member of the nuclear hormone receptor family, specifically the NR1 subfamily of receptors. The encoded protein functions as a transcriptional repressor and may play a role in circadian rhythms and carbohydrate and lipid metabolism. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2009]
• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors