HDHD3 (NM_031219) Human Mass Spec Standard

CAT#: PH306402

HDHD3 MS Standard C13 and N15-labeled recombinant protein (NP_112496)

Product Images

Coomassie blue staining of purified HDHD3 protein (Cat# TP306402). The protein was produced from HEK293T cells transfected with HDHD3 cDNA clone (Cat# RC206402) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206402
• Predicted MW: 28 kDa
• Protein Sequence:
  Sequence Link

  >RC206402 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAHRLQIRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLT
  SRQWWLDVVLQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRR
  LEGILGGLGLREHFDFVLTSEAAGWPKPDPRIFQEALRLAHMEPVVAAHVGDNYLCDYQGPRAVGMHSFL
  VVGPQALDPVVRDSVPKEHILPSLAHLLPALDCLEGSTPGL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_112496
• RefSeq Size: 1787
• RefSeq ORF: 753
• Synonyms: 2810435D12Rik; C9orf158
• Locus ID: 81932
• UniProt ID: Q9BSH5
• Cytogenetics: 9q32
• Summary: Belongs to the HAD-like hydrolase superfamily. [UniProtKB/Swiss-Prot Function]