FOXI1 (NM_144769) Human Mass Spec Standard

CAT#: PH306430

FOXI1 MS Standard C13 and N15-labeled recombinant protein (NP_658982)

Product Images

Coomassie blue staining of purified FOXI1 protein (Cat# TP306430). The protein was produced from HEK293T cells transfected with FOXI1 cDNA clone (Cat# RC206430) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206430
• Predicted MW: 30.8 kDa
• Protein Sequence:
  Sequence Link

  >RC206430 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFEGGGEYGATPNPYLWFNGPTM
  TPPPYLPGPNASPFLPQAYGVQRPLLPSVSGLGGSDLGWLPIPSQEELMKLVRPPYSYSALIAMAIHGAP
  DKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPAYVSGGSPTSHPLVTPGLS
  PEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGGSVLSQFSPHFYNSVNTSGVLYPREG
  TEV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_658982
• RefSeq Size: 2011
• RefSeq ORF: 849
• Synonyms: FKH10; FKHL10; FREAC-6; FREAC6; HFH-3; HFH3
• Locus ID: 2299
• UniProt ID: Q12951
• Cytogenetics: 5q35.1
• Summary: 'This gene belongs to the forkhead family of transcription factors, which is characterized by a distinct forkhead domain. This gene may play an important role in the development of the cochlea and vestibulum, as well as in embryogenesis. The encoded protein has been found to be required for the transcription of four subunits of a proton pump found in the inner ear, the kidney, and the epididymis. Mutations in this gene have been associated with deafness, autosomal recessive 4. [provided by RefSeq, Jan 2017]'
• Protein Families: Transcription Factors