Myozenin 1 (MYOZ1) (NM_021245) Human Mass Spec Standard

CAT#: PH306448

MYOZ1 MS Standard C13 and N15-labeled recombinant protein (NP_067068)

Product Images

Coomassie blue staining of purified MYOZ1 protein (Cat# TP306448). The protein was produced from HEK293T cells transfected with MYOZ1 cDNA clone (Cat# RC206448) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206448
• Predicted MW: 31.7 kDa
• Protein Sequence:
  Sequence Link

  >RC206448 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPLSGTPAPNKKRKSSKLIMELTGGGQESSGLNLGKKISVPRDVMLEELSLLTNRGSKMFKLRQMRVEKF
  IYENHPDVFSDSSMDHFQKFLPTVGGQLGTAGQGFSYSKSNGRGGSQAGGSGSAGQYGSDQQHHLGSGSG
  AGGTGGPAGQAGRGGAAGTAGVGETGSGDQAGGEGKHITVFKTYISPWERAMGVDPQQKMELGIDLLAYG
  AKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGE
  PVDYNVDIGIPLDGETEEL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_067068
• RefSeq Size: 1583
• RefSeq ORF: 897
• Synonyms: CS-2; FATZ; MYOZ
• Locus ID: 58529
• UniProt ID: Q9NP98
• Cytogenetics: 10q22.2
• Summary: The protein encoded by this gene is primarily expressed in the skeletal muscle, and belongs to the myozenin family. Members of this family function as calcineurin-interacting proteins that help tether calcineurin to the sarcomere of cardiac and skeletal muscle. They play an important role in modulation of calcineurin signaling. [provided by RefSeq, Apr 2012]