Myozenin 1 (MYOZ1) (NM_021245) Human Recombinant Protein

CAT#: TP306448

Recombinant protein of human myozenin 1 (MYOZ1)

Product Images

Coomassie blue staining of purified MYOZ1 protein (Cat# TP306448). The protein was produced from HEK293T cells transfected with MYOZ1 cDNA clone (Cat# RC206448) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206448 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPLSGTPAPNKKRKSSKLIMELTGGGQESSGLNLGKKISVPRDVMLEELSLLTNRGSKMFKLRQMRVEKF
  IYENHPDVFSDSSMDHFQKFLPTVGGQLGTAGQGFSYSKSNGRGGSQAGGSGSAGQYGSDQQHHLGSGSG
  AGGTGGPAGQAGRGGAAGTAGVGETGSGDQAGGEGKHITVFKTYISPWERAMGVDPQQKMELGIDLLAYG
  AKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGE
  PVDYNVDIGIPLDGETEEL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 31.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_067068
• Locus ID: 58529
• UniProt ID: Q9NP98
• Cytogenetics: 10q22.2
• Refseq Size: 1583
• Refseq ORF: 897
• Synonyms: CS-2; FATZ; MYOZ
• Summary: The protein encoded by this gene is primarily expressed in the skeletal muscle, and belongs to the myozenin family. Members of this family function as calcineurin-interacting proteins that help tether calcineurin to the sarcomere of cardiac and skeletal muscle. They play an important role in modulation of calcineurin signaling. [provided by RefSeq, Apr 2012]