WFDC1 (NM_021197) Human Mass Spec Standard

CAT#: PH306450

WFDC1 MS Standard C13 and N15-labeled recombinant protein (NP_067020)

Product Images

Coomassie blue staining of purified WFDC1 protein (Cat# TP306450). The protein was produced from HEK293T cells transfected with WFDC1 cDNA clone (Cat# RC206450) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206450
• Predicted MW: 20.6 kDa
• Protein Sequence:
  Sequence Link

  >RC206450 representing NM_021197
  Red=Cloning site Green=Tags(s)
  
  MPLTGVGPGSCRRQIIRALCLLLLLLHAGSAKNIWKRALPARLAEKSRAEEAGAPGGPRQPRADRCPPPP
  RTLPPGACQAARCQADSECPRHRRCCYNGCAYACLEAVPPPPVLDWLVQPKPRWLGGNGWLLDGPEEVLQ
  AEACSTTEDGAEPLLCPSGYECHILSPGDVAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAE
  PGRGQQKHFQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_067020
• RefSeq Size: 1396
• RefSeq ORF: 660
• Synonyms: PS20
• Locus ID: 58189
• UniProt ID: Q9HC57
• Cytogenetics: 16q24.1
• Summary: This gene encodes a member of the WAP-type four disulfide core domain family. The WAP-type four-disulfide core domain contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is mapped to chromosome 16q24, an area of frequent loss of heterozygosity in cancers, including prostate, breast and hepatocellular cancers and Wilms' tumor. This gene is downregulated in many cancer types and may be involved in the inhibition of cell proliferation. The encoded protein may also play a role in the susceptibility of certain CD4 memory T cells to human immunodeficiency virus infection. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]
• Protein Families: Secreted Protein