HBZ (NM_005332) Human Mass Spec Standard

CAT#: PH306504

HBZ MS Standard C13 and N15-labeled recombinant protein (NP_005323)

Product Images

Coomassie blue staining of purified HBZ protein (Cat# TP306504). The protein was produced from HEK293T cells transfected with HBZ cDNA clone (Cat# RC206504) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206504
• Predicted MW: 15.6 kDa
• Protein Sequence:
  Sequence Link

  >RC206504 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDA
  VKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEK
  YR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005323
• RefSeq Size: 589
• RefSeq ORF: 426
• Synonyms: HBAZ; HBZ-T1; HBZ1
• Locus ID: 3050
• UniProt ID: P02008
• Cytogenetics: 16p13.3
• Summary: 'Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult life. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes. The order of genes is: 5' - zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 -alpha-1 - theta1 - 3'. [provided by RefSeq, Nov 2009]'
• Protein Families: Embryonic stem cells, ES Cell Differentiation/IPS