HBZ (NM_005332) Human Recombinant Protein

CAT#: TP306504

Recombinant protein of human hemoglobin, zeta (HBZ)

Product Images

Coomassie blue staining of purified HBZ protein (Cat# TP306504). The protein was produced from HEK293T cells transfected with HBZ cDNA clone (Cat# RC206504) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206504 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDA
  VKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEK
  YR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 15.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005323
• Locus ID: 3050
• UniProt ID: P02008
• Cytogenetics: 16p13.3
• Refseq Size: 589
• Refseq ORF: 426
• Synonyms: HBAZ; HBZ-T1; HBZ1
• Summary: Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult life. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes. The order of genes is: 5' - zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 -alpha-1 - theta1 - 3'. [provided by RefSeq, Nov 2009]
• Protein Families: Embryonic stem cells, ES Cell Differentiation/IPS