COX6A2 (NM_005205) Human Mass Spec Standard

CAT#: PH306539

COX6A2 MS Standard C13 and N15-labeled recombinant protein (NP_005196)

Product Images

Coomassie blue staining of purified COX6A2 protein (Cat# TP306539). The protein was produced from HEK293T cells transfected with COX6A2 cDNA clone (Cat# RC206539) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206539
• Predicted MW: 10.8 kDa
• Protein Sequence:
  Sequence Link

  >RC206539 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFRPYQHLRIRTK
  PYPWGDGNHTLFHNSHVNPLPTGYEHP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005196
• RefSeq Size: 441
• RefSeq ORF: 291
• Synonyms: COX6AH; COXVIAH
• Locus ID: 1339
• UniProt ID: Q02221
• Cytogenetics: 16p11.2
• Summary: 'Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 2 (heart/muscle isoform) of subunit VIa, and polypeptide 2 is present only in striated muscles. Polypeptide 1 (liver isoform) of subunit VIa is encoded by a different gene, and is found in all non-muscle tissues. These two polypeptides share 66% amino acid sequence identity. [provided by RefSeq, Jul 2008]'
• Protein Pathways: Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease