ARSB (NM_198709) Human Mass Spec Standard
CAT#: PH306565
ARSB MS Standard C13 and N15-labeled recombinant protein (NP_942002)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206565 |
Predicted MW | 46 kDa |
Protein Sequence |
>RC206565 protein sequence
Red=Cloning site Green=Tags(s) MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTP HLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTT HMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMY STNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNV TAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHI SDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPYWPECSLLL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_942002 |
RefSeq Size | 2172 |
RefSeq ORF | 1239 |
Synonyms | ASB; G4S; MPS6 |
Locus ID | 411 |
UniProt ID | P15848, A8K4A0 |
Cytogenetics | 5q14.1 |
Summary | 'Arylsulfatase B encoded by this gene belongs to the sulfatase family. The arylsulfatase B homodimer hydrolyzes sulfate groups of N-Acetyl-D-galactosamine, chondriotin sulfate, and dermatan sulfate. The protein is targeted to the lysozyme. Mucopolysaccharidosis type VI is an autosomal recessive lysosomal storage disorder resulting from a deficiency of arylsulfatase B. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Dec 2016]' |
Protein Families | Druggable Genome |
Protein Pathways | Glycosaminoglycan degradation, Lysosome, Metabolic pathways |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400011 | ARSB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC404825 | ARSB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400011 | Transient overexpression lysate of arylsulfatase B (ARSB), transcript variant 1 |
USD 495.00 |
|
LY404825 | Transient overexpression lysate of arylsulfatase B (ARSB), transcript variant 2 |
USD 325.00 |
|
PH314604 | ARSB MS Standard C13 and N15-labeled recombinant protein (NP_000037) |
USD 2,055.00 |
|
TP306565 | Recombinant protein of human arylsulfatase B (ARSB), transcript variant 2 |
USD 823.00 |
|
TP314604 | Recombinant protein of human arylsulfatase B (ARSB), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review