MDC (CCL22) (NM_002990) Human Mass Spec Standard
CAT#: PH306578
CCL22 MS Standard C13 and N15-labeled recombinant protein (NP_002981)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206578 |
Predicted MW | 10.6 kDa |
Protein Sequence |
>RC206578 protein sequence
Red=Cloning site Green=Tags(s) MARLQTALLVVLVLLAVALQATEAGPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTF RDKEICADPRVPWVKMILNKLSQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002981 |
RefSeq Size | 2933 |
RefSeq ORF | 279 |
Synonyms | A-152E5.1; ABCD-1; DC/B-CK; MDC; SCYA22; STCP-1 |
Locus ID | 6367 |
UniProt ID | O00626 |
Cytogenetics | 16q21 |
Summary | 'This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, dendritic cells, natural killer cells and for chronically activated T lymphocytes. It also displays a mild activity for primary activated T lymphocytes and has no chemoattractant activity for neutrophils, eosinophils and resting T lymphocytes. The product of this gene binds to chemokine receptor CCR4. This chemokine may play a role in the trafficking of activated T lymphocytes to inflammatory sites and other aspects of activated T lymphocyte physiology. [provided by RefSeq, Sep 2014]' |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418968 | CCL22 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY418968 | Transient overexpression lysate of chemokine (C-C motif) ligand 22 (CCL22) |
USD 325.00 |
|
TP306578 | Recombinant protein of human chemokine (C-C motif) ligand 22 (CCL22) |
USD 823.00 |
|
TP723291 | Purified recombinant protein of Human chemokine (C-C motif) ligand 22 (CCL22). |
USD 240.00 |
|
TP723292 | Purified recombinant protein of Human chemokine (C-C motif) ligand 22 (CCL22). |
USD 240.00 |
|
TP723815 | Purified recombinant protein of Human chemokine (C-C motif) ligand 22 (CCL22 / MDC) |
USD 205.00 |
{0} Product Review(s)
Be the first one to submit a review