MDC (CCL22) (NM_002990) Human Recombinant Protein
CAT#: TP723292
Purified recombinant protein of Human chemokine (C-C motif) ligand 22 (CCL22).
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ
|
Tag | Tag Free |
Predicted MW | 8.1 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by its ability to chemoattract human T cells using a concentration range of 10.0-100.0 ng/ml. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002981 |
Locus ID | 6367 |
UniProt ID | O00626 |
Cytogenetics | 16q21 |
Refseq Size | 2933 |
Refseq ORF | 279 |
Synonyms | A-152E5.1; ABCD-1; DC/B-CK; MDC; SCYA22; STCP-1 |
Summary | 'This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, dendritic cells, natural killer cells and for chronically activated T lymphocytes. It also displays a mild activity for primary activated T lymphocytes and has no chemoattractant activity for neutrophils, eosinophils and resting T lymphocytes. The product of this gene binds to chemokine receptor CCR4. This chemokine may play a role in the trafficking of activated T lymphocytes to inflammatory sites and other aspects of activated T lymphocyte physiology. [provided by RefSeq, Sep 2014]' |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418968 | CCL22 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY418968 | Transient overexpression lysate of chemokine (C-C motif) ligand 22 (CCL22) |
USD 325.00 |
|
PH306578 | CCL22 MS Standard C13 and N15-labeled recombinant protein (NP_002981) |
USD 2,055.00 |
|
TP306578 | Recombinant protein of human chemokine (C-C motif) ligand 22 (CCL22) |
USD 823.00 |
|
TP723291 | Purified recombinant protein of Human chemokine (C-C motif) ligand 22 (CCL22). |
USD 240.00 |
|
TP723815 | Purified recombinant protein of Human chemokine (C-C motif) ligand 22 (CCL22 / MDC) |
USD 205.00 |
{0} Product Review(s)
Be the first one to submit a review