PHETA1 (NM_144671) Human Mass Spec Standard

CAT#: PH306625

FAM109A MS Standard C13 and N15-labeled recombinant protein (NP_653272)

Product Images

Coomassie blue staining of purified PHETA1 protein (Cat# TP306625). The protein was produced from HEK293T cells transfected with PHETA1 cDNA clone (Cat# RC206625) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206625
• Predicted MW: 27.2 kDa
• Protein Sequence:
  Sequence Link

  >RC206625 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKLNERSLAFYATCDAPVDNAGFLYKKGGRHAAYHRRWFVLRGNMLFYFEDAASREPVGVIILEGCTVEL
  VEAAEEFAFAVRFAGTRARTYVLAAESQDAMEGWVKALSRASFDYLRLVVRELEQQLAAVRGGGGMALPQ
  PQPQSLPLPPSLPSALAPVPSLPSAPAPVPALPLPRRPSALPPKENGCAVWSTEATFRPGPEPPPPPPRR
  RASAPHGPLDMAPFARLHECYGQEIRALRGQWLSSRVQP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_653272
• RefSeq Size: 3168
• RefSeq ORF: 747
• Synonyms: FAM109A; IPIP27A; SES1
• Locus ID: 144717
• UniProt ID: Q8N4B1
• Cytogenetics: 12q24.12
• Summary: This gene encodes a protein that localizes to the endosome and interacts with the enzyme, inositol polyphosphate 5-phosphatase OCRL-1. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010]