PHETA1 (NM_144671) Human Recombinant Protein

CAT#: TP306625

Recombinant protein of human family with sequence similarity 109, member A (FAM109A)

Product Images

Coomassie blue staining of purified PHETA1 protein (Cat# TP306625). The protein was produced from HEK293T cells transfected with PHETA1 cDNA clone (Cat# RC206625) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206625 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKLNERSLAFYATCDAPVDNAGFLYKKGGRHAAYHRRWFVLRGNMLFYFEDAASREPVGVIILEGCTVEL
  VEAAEEFAFAVRFAGTRARTYVLAAESQDAMEGWVKALSRASFDYLRLVVRELEQQLAAVRGGGGMALPQ
  PQPQSLPLPPSLPSALAPVPSLPSAPAPVPALPLPRRPSALPPKENGCAVWSTEATFRPGPEPPPPPPRR
  RASAPHGPLDMAPFARLHECYGQEIRALRGQWLSSRVQP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_653272
• Locus ID: 144717
• UniProt ID: Q8N4B1
• Cytogenetics: 12q24.12
• Refseq Size: 3168
• Refseq ORF: 747
• Synonyms: FAM109A; IPIP27A; SES1
• Summary: This gene encodes a protein that localizes to the endosome and interacts with the enzyme, inositol polyphosphate 5-phosphatase OCRL-1. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010]