Cytoglobin (CYGB) (NM_134268) Human Mass Spec Standard

CAT#: PH306642

CYGB MS Standard C13 and N15-labeled recombinant protein (NP_599030)

Product Images

Coomassie blue staining of purified CYGB protein (Cat# TP306642). The protein was produced from HEK293T cells transfected with CYGB cDNA clone (Cat# RC206642) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206642
• Predicted MW: 21.4 kDa
• Protein Sequence:
  Sequence Link

  >RC206642 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPL
  EMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFA
  SDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_599030
• RefSeq Size: 2166
• RefSeq ORF: 570
• Synonyms: HGB; STAP
• Locus ID: 114757
• UniProt ID: Q8WWM9, A0A1K0FUB6
• Cytogenetics: 17q25.1
• Summary: This gene encodes a globin protein found in vertebrate cells. The encoded protein is described as a hexacoordinate hemoglobin which binds ligand differently from the pentacoordinate hemoglobins involved in oxygen transport, and may be involved in protection during oxidative stress. This gene is located on chromosome 17 in the same region as a retinal gene which is mutated in progressive rod-cone degeneration, but in the opposite orientation. [provided by RefSeq, Jan 2012]