STK22C (TSSK3) (NM_052841) Human Mass Spec Standard

CAT#: PH306673

TSSK3 MS Standard C13 and N15-labeled recombinant protein (NP_443073)

Product Images

Coomassie blue staining of purified TSSK3 protein (Cat# TP306673). The protein was produced from HEK293T cells transfected with TSSK3 cDNA clone (Cat# RC206673) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206673
• Predicted MW: 29.9 kDa
• Protein Sequence:
  Sequence Link

  >RC206673 representing NM_052841
  Red=Cloning site Green=Tags(s)
  
  MEDFLLSNGYQLGKTIGEGTYSKVKEAFSKKHQRKVAIKVIDKMGGPEEFIQRFLPRELQIVRTLDHKNI
  IQVYEMLESADGKICLVMELAEGGDVFDCVLNGGPLPESRAKALFRQMVEAIRYCHGCGVAHRDLKCENA
  LLQGFNLKLTDFGFAKVLPKSHRELSQTFCGSTAYAAPEVLQGIPHDSKKGDVWSMGVVLYVMLCASLPF
  DDTDIPKMLWQQQKGVSFPTHLSISADCQDLLKRLLEPDMILRPSIEEVSWHPWLAST
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_443073
• RefSeq Size: 1330
• RefSeq ORF: 804
• Synonyms: SPOGA3; STK22C; STK22D; TSK3
• Locus ID: 81629
• UniProt ID: Q96PN8
• Cytogenetics: 1p35.1
• Summary: This gene encodes a kinase expressed exclusively in the testis that is thought to play a role in either germ cell differentiation or mature sperm function. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Protein Kinase