STK22C (TSSK3) (NM_052841) Human Recombinant Protein

CAT#: TP306673

Recombinant protein of human testis-specific serine kinase 3 (TSSK3)

Product Images

Coomassie blue staining of purified TSSK3 protein (Cat# TP306673). The protein was produced from HEK293T cells transfected with TSSK3 cDNA clone (Cat# RC206673) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206673 representing NM_052841
  Red=Cloning site Green=Tags(s)
  
  MEDFLLSNGYQLGKTIGEGTYSKVKEAFSKKHQRKVAIKVIDKMGGPEEFIQRFLPRELQIVRTLDHKNI
  IQVYEMLESADGKICLVMELAEGGDVFDCVLNGGPLPESRAKALFRQMVEAIRYCHGCGVAHRDLKCENA
  LLQGFNLKLTDFGFAKVLPKSHRELSQTFCGSTAYAAPEVLQGIPHDSKKGDVWSMGVVLYVMLCASLPF
  DDTDIPKMLWQQQKGVSFPTHLSISADCQDLLKRLLEPDMILRPSIEEVSWHPWLAST
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 29.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_443073
• Locus ID: 81629
• UniProt ID: Q96PN8
• Cytogenetics: 1p35.1
• Refseq Size: 1330
• Refseq ORF: 804
• Synonyms: SPOGA3; STK22C; STK22D; TSK3
• Summary: This gene encodes a kinase expressed exclusively in the testis that is thought to play a role in either germ cell differentiation or mature sperm function. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Protein Kinase