IGSF11 (NM_152538) Human Mass Spec Standard

CAT#: PH306735

IGSF11 MS Standard C13 and N15-labeled recombinant protein (NP_689751)

Product Images

Coomassie blue staining of purified IGSF11 protein (Cat# TP306735). The protein was produced from HEK293T cells transfected with IGSF11 cDNA clone (Cat# RC206735) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206735
• Predicted MW: 46.2 kDa
• Protein Sequence:
  Sequence Link

  >RC206735 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLVELLLWWNCFSRTGVAASLEVSESPGSIQVARGQTAVLPCTFTTSAALINLNVIWMVTPLSNANQPE
  QVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVL
  VPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSG
  LYQCVASNAIGTSTCLLDLQVISPQPRNIGLIAGAIGTGAVIIIFCIALILGAFFYWRSKNKEEEEEEIP
  NEIREDDLPPKCSSAKAFHTEISSSDNNTLTSSNAYNSRYWSNNPKVHRNTESVSHFSDLGQSFSFHSGN
  ANIPSIYANGTHLVPGQHKTLVVTANRGSSPQVMSRSNGSVSRKPRPPHTHSYTISHATLERIGAVPVMV
  PAQSRAGSLV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_689751
• RefSeq Size: 3577
• RefSeq ORF: 1290
• Synonyms: BT-IgSF; CT119; CXADRL1; Igsf13; VSIG3
• Locus ID: 152404
• UniProt ID: Q5DX21
• Cytogenetics: 3q13.32
• Summary: IGSF11 is an immunoglobulin (Ig) superfamily member that is preferentially expressed in brain and testis. It shares significant homology with coxsackievirus and adenovirus receptor (CXADR; MIM 602621) and endothelial cell-selective adhesion molecule (ESAM). [supplied by OMIM, Apr 2005]
• Protein Families: Transmembrane